PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG230900.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 873aa    MW: 93572.8 Da    PI: 5.8924
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG230900.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.71.3e-20130185156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          +++ +++t++q++++e+lF+++++p+ ++r +L+++lgL+ rqVk+WFqNrR+++k
  Pavir.9KG230900.3.p 130 KKRYHRHTAHQIQQMEALFKECPHPDDKQRLKLSQELGLKPRQVKFWFQNRRTQMK 185
                          688999***********************************************998 PP

2START127.81.3e-403545902206
                          HHHHHHHHHHHHHHHC-TT-EEEE......EXCCTTEEEEEEESSS...................SCEEEEEEEECCSCHHHHHHHHHCC CS
                START   2 laeeaaqelvkkalaeepgWvkss......esengdevlqkfeeskv..................dsgealrasgvvdmvlallveelld 67 
                          la +aa+ l ++  a+ep+Wv+ +                  e ++                    ++e +r+s+vv+m++ +lv  +ld
  Pavir.9KG230900.3.p 354 LAATAADTLARMCRAGEPLWVRRRgassevM--------VPDEHARMfswpvdggkqgggstpaaARTEGSRDSAVVIMNSITLVDAFLD 435
                          5778999999************994444431........333333334555566678899999999************************ PP

                          CGGCT-TT-S....EEEEEEEECTT........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE..TTS-EEEEEEEEE-TTS--..-TTS CS
                START  68 dkeqWdetla....kaetlevissg........galqlmvaelqalsplvp.RdfvfvRyirq.lgagdwvivdvSvdseqkppe.sssv 142
                           + +W e ++    ka t++vi+ g        g l+lm+ae q++splvp R+++f Ry+    ++g+w +vd   +  q     +ssv
  Pavir.9KG230900.3.p 436 AN-KWMELFPsivsKARTIQVINHGaasghlgsGSLVLMQAEVQFPSPLVPaREVMFFRYCVHnAEEGTWSVVDFPAEGFQLEALqTSSV 524
                          **.************************************************************99*********888888877779**** PP

                          EE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXX..HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 143 vRaellpSgiliepksnghskvtwvehvdlkgrlp..hwllrslvksglaegaktwvatlqrqcek 206
                          v+++++pSg++i++++ng+s v+wveh+++ g     h++++  v sg+a+ga +w + lqrqce+
  Pavir.9KG230900.3.p 525 VKCRRRPSGCIIQDMPNGYSSVVWVEHMEMVGEEKplHQVFKDYVASGTAFGATRWISLLQRQCER 590
                          *****************************98765449***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.5E-21119181IPR009057Homeodomain-like
SuperFamilySSF466891.96E-19121188IPR009057Homeodomain-like
PROSITE profilePS5007116.989127187IPR001356Homeobox domain
SMARTSM003891.1E-19128191IPR001356Homeobox domain
CDDcd000866.86E-19130188No hitNo description
PfamPF000463.7E-18130185IPR001356Homeobox domain
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084843.152344593IPR002913START domain
SuperFamilySSF559612.33E-28347592No hitNo description
SMARTSM002342.5E-17353590IPR002913START domain
PfamPF018521.2E-32354590IPR002913START domain
CDDcd088759.26E-101364589No hitNo description
SuperFamilySSF559612.06E-14607850No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 873 aa     Download sequence    Send to blast
MFGDCQVLSS MAAMAGASSS ADALFIPNPG ALAGFMSSSA AAAMPFHHFS TASLIPEEGG  60
IMGALVPVAK DEDMELEMDM ELSGGSGGGH LDGLLSFADD DWPEQKPSGL ELQTVDAAGN  120
QQLATNTGKK KRYHRHTAHQ IQQMEALFKE CPHPDDKQRL KLSQELGLKP RQVKFWFQNR  180
RTQMKAQQDR ADNVLLRAEN ESLKADNYRL QAAIRNVVCP TCGHAAVLAE MSFEEQQLRV  240
ENARLKDELD RLACMATRYG GGRQPGMSSS ALGCISAPAP HLLMPPLNLD MSVYSRHFTD  300
QSPVMGCGDL IQSVLAPPPS QQITAGAEHH DASPYMGSAM APVPEQDRQQ VLDLAATAAD  360
TLARMCRAGE PLWVRRRGAS SEVMVPDEHA RMFSWPVDGG KQGGGSTPAA ARTEGSRDSA  420
VVIMNSITLV DAFLDANKWM ELFPSIVSKA RTIQVINHGA ASGHLGSGSL VLMQAEVQFP  480
SPLVPAREVM FFRYCVHNAE EGTWSVVDFP AEGFQLEALQ TSSVVKCRRR PSGCIIQDMP  540
NGYSSVVWVE HMEMVGEEKP LHQVFKDYVA SGTAFGATRW ISLLQRQCER LASELARNIA  600
DPRVIHTPEA RTNMMKLSQR MITTFCANIS ASGSQSWTAL SESTEDTIRV TTRKNTDPGQ  660
PSGVILTAVS TSWLPFSHQQ VFELLADEQQ RCQLEILSNE GSLHEVAHIA NGSHPRNCIS  720
LLRINAASNS SQNVELLLQE SSTHPNGGSL VVFGTVDVYA IQVTMSGGDP SYIPLLPLGF  780
AIFPAANPSP AATSESSGNG ESSPGNPDVP ATGCLLTVGM QVLASAVPSA KLNLSSVTAI  840
NSHVCNAIHQ ITTALKGAGA SRAEPASVGG SN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1398404GGKQGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.76670.0callus| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004983555.10.0PREDICTED: homeobox-leucine zipper protein ROC3
RefseqXP_004983556.10.0PREDICTED: homeobox-leucine zipper protein ROC3
SwissprotA2ZAI70.0ROC3_ORYSI; Homeobox-leucine zipper protein ROC3
TrEMBLK4A5P80.0K4A5P8_SETIT; Uncharacterized protein
STRINGSi034202m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G46880.10.0homeobox-7